PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A05G1786
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 319aa    MW: 35049.9 Da    PI: 8.7315
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A05G1786genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.57.4e-193378147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEde l ++v+ +G+++W++I++ ++ gR++k+c++rw + 
      Gh_A05G1786 33 KGPWSPEEDEALQRLVHTYGPKNWSLISKSIP-GRSGKSCRLRWCNQ 78
                     79******************************.***********985 PP

2Myb_DNA-binding51.81.8e-1687129347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+ +++a+ q+G++ W+ Iar ++ gRt++ +k++w++ 
      Gh_A05G1786  87 PFTPEEDDTIIQAHVQFGNK-WAIIARLLN-GRTDNAIKDHWNST 129
                      89******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.6472879IPR017930Myb domain
SuperFamilySSF466896.83E-3230126IPR009057Homeodomain-like
SMARTSM007171.1E-173281IPR001005SANT/Myb domain
PfamPF002499.1E-193378IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-263486IPR009057Homeodomain-like
CDDcd001675.76E-173577No hitNo description
PROSITE profilePS5129425.27280134IPR017930Myb domain
SMARTSM007172.3E-1484132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-2387133IPR009057Homeodomain-like
PfamPF002495.0E-1487129IPR001005SANT/Myb domain
CDDcd001671.39E-1187130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MKYVASMKMS CLSYVKLAYN ISSCEKKDLD RIKGPWSPEE DEALQRLVHT YGPKNWSLIS  60
KSIPGRSGKS CRLRWCNQLS PEVQHRPFTP EEDDTIIQAH VQFGNKWAII ARLLNGRTDN  120
AIKDHWNSTL KRKCSSMTQD LNNDSPQPIK RSASLGAANN VSGPCLNLGT PSGSDLSDSS  180
LPAASPFYKL LARTGSSKHV ETASSTTNPP IILSLSLPGF DPCKNSDSGP RSDPIPSPTQ  240
APVTTVTAHP TAGLVVGMQN GELGMEKQFF SNEFLTVIQE MIRTEVRNYM FGIEQNGLCL  300
QTEAIRNAVV KRIGISKIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C1e-40321333104C-Myb DNA-Binding Domain
1msf_C1e-40321333104C-Myb DNA-Binding Domain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012446268.10.0PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW14e-85MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0D2URN50.0A0A0D2URN5_G
STRINGPOPTR_0002s12410.11e-136(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.11e-81myb domain protein 73